PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009884
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 293aa    MW: 32660.2 Da    PI: 8.7879
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009884genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-082167346
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqk 46
                      WT+eE + +  a + +G +    +W ++a++++ g++  +++  ++ 
      Lus10009884 21 YWTKEENKAFESALAIYGDEhdpdRWFKVAAMIP-GKSVSDVIKQYRE 67
                     5*****************99**************.*******999986 PP

2Myb_DNA-binding43.29.3e-14126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++++  ++G+g+W+ I+r +   +t+ q+ s+ qky
      Lus10009884 126 PWTEDEHRRFLKGLMKYGKGDWRNISRNFVVSKTPTQVASHAQKY 170
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-41467IPR009057Homeodomain-like
PROSITE profilePS512939.7351773IPR017884SANT domain
SMARTSM007174.6E-91871IPR001005SANT/Myb domain
PfamPF002491.7E-72167IPR001005SANT/Myb domain
CDDcd001675.06E-92268No hitNo description
SuperFamilySSF466891.94E-92276IPR009057Homeodomain-like
PROSITE profilePS5129419.034118175IPR017930Myb domain
SuperFamilySSF466894.86E-16120175IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-19122174IPR006447Myb domain, plants
SMARTSM007179.9E-12123173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-11123169IPR009057Homeodomain-like
CDDcd001676.21E-10126171No hitNo description
PfamPF002493.4E-11126170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGAAVYQHFY MPQNDDVASE YWTKEENKAF ESALAIYGDE HDPDRWFKVA AMIPGKSVSD  60
VIKQYRELEE DVGDIEAGRV ALPGYFPGGG DEDDCSSFTL ELIDSFRKRP LGSTKTSDQG  120
RKKGVPWTED EHRRFLKGLM KYGKGDWRNI SRNFVVSKTP TQVASHAQKY FIRQQLSGVK  180
DKRRPSIHDI TTVNLSSLDS SSAAAANSTT LELSGLFSSP AVSKYNQNKA SWNVHQHTTA  240
SSPSSNSLFM VASSSPYINY YDHMASSLHH QGHQKNLYSA AFQTSNARRI RG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-1322911179RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAPTransfer from AT3G11280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530418.11e-93PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H78e-72DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9SWP91e-93B9SWP9_RICCO; DNA binding protein, putative
STRINGPOPTR_0010s20040.14e-90(Populus trichocarpa)
STRINGGLYMA14G06750.15e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.26e-79MYB family protein